PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_14377_iso_5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 268aa    MW: 30387.7 Da    PI: 4.7801
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_14377_iso_5genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.71.1e-172671148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                          rg++++eE+ ++v+++ +lG++ W++I+++++ gRt++++k++w+++l
  cra_locus_14377_iso_5_len_2319_ver_3 26 RGPFSPEEENIIVRLHSMLGNK-WAAISSHLP-GRTDNEIKNFWNSHL 71
                                          89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.298120IPR017877Myb-like domain
SuperFamilySSF466893.59E-22776IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-11732IPR009057Homeodomain-like
PROSITE profilePS5129426.4832175IPR017930Myb domain
SMARTSM007172.9E-172573IPR001005SANT/Myb domain
PfamPF002491.2E-162671IPR001005SANT/Myb domain
CDDcd001673.37E-122871No hitNo description
Gene3DG3DSA:1.10.10.606.5E-233372IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
IIAGLLRCGK SCRLRWTNYL RPDIKRGPFS PEEENIIVRL HSMLGNKWAA ISSHLPGRTD  60
NEIKNFWNSH LKKRATASMD QSSYQPSFFS ESSDDANLES QSTQHMVQWE RATLEAEIQL  120
SKDPLLLNSQ SAVKTENDYF LRLWNSEVGE SFRKVNDYEV ACQSPVSQVS SSTRDESSSG  180
VTIHTNDPPR VLLSPARTTN TQKHAENVSV KKDPEDHLIL GSESSKSYEL DESSDATMKL  240
LLDFPQGDEM EYLQEPVEDV SIYLQDPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-2077540108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011076175.13e-92PREDICTED: transcription factor MYB3-like
TrEMBLA0A068UAM31e-114A0A068UAM3_COFCA; Uncharacterized protein
STRINGVIT_16s0050g00070.t011e-83(Vitis vinifera)